Analytical Data
-
Gene name
TMEM81
- Application
-
Alternative Names
HC3107; KVLA2788; MGC75217; Tmem81; TMM81_HUMAN; Transmembrane Protein 81; UNQ2788
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6P7N7
-
Expression Region
1-255 aa
-
AA Sequence
MKVLATSFVLGSLGLAFYLPLVVTTPKTLAIPEKLQEAVGKVIINATTCTVTCGLGYKEETVCEVGPDGVRRKCQTRRLECLTNWICGMLHFTILIGKEFELSCLSSDILEFGQEAFRFTWRLARGVISTDDEVFKPFQANSHFVKFKYAQEYDSGTYRCDVQLVKNLRLVKRLYFGLRVLPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWKKKVASALGIGIAIGVVGGVLVRIVLCALRGGLQQ
-
Molecular Weight
54.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM81, or Transmembrane Protein 81, has garnered significant attention in recent years due to its potential roles in cellular processes and disease pathways. This protein is implicated in various biological functions, including membrane biology, ion transport, and signal transduction, making it a candidate for studying various cellular mechanisms. Research has suggested that TMEM81 may be involved in modulating cellular responses to stress, influencing cellular proliferation and differentiation. Its expression pattern is notably varied across different tissues, hinting at specialized functions in particular cellular environments. Furthermore, emerging studies have proposed that aberrations in TMEM81 expression or function could be linked to several pathologies, including neurodegenerative diseases and certain cancers, which underscores its potential as a therapeutic target. Consequently, the generation of recombinant TMEM81 protein has become a crucial step in facilitating comprehensive studies of its structure, function, and interactions. By utilizing recombinant DNA technology, researchers can produce large quantities of purified TMEM81, enabling in-depth biochemical assays and structural analyses. Understanding its functional dynamics may provide insights into its role in health and disease, paving the way for potential clinical applications. The ongoing research into TMEM81 not only enhances our knowledge of membrane proteins but also opens new avenues for biomedicine, highlighting the importance of continued investigation into this enigmatic protein.











