Cat: PAX2000-12052

Recombinant Human TMEM81 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TMEM81

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HC3107; KVLA2788; MGC75217; Tmem81; TMM81_HUMAN; Transmembrane Protein 81; UNQ2788

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q6P7N7

  • Expression Region

    1-255 aa

  • AA Sequence

    MKVLATSFVLGSLGLAFYLPLVVTTPKTLAIPEKLQEAVGKVIINATTCTVTCGLGYKEETVCEVGPDGVRRKCQTRRLECLTNWICGMLHFTILIGKEFELSCLSSDILEFGQEAFRFTWRLARGVISTDDEVFKPFQANSHFVKFKYAQEYDSGTYRCDVQLVKNLRLVKRLYFGLRVLPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWKKKVASALGIGIAIGVVGGVLVRIVLCALRGGLQQ

  • Molecular Weight

    54.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TMEM81, or Transmembrane Protein 81, has garnered significant attention in recent years due to its potential roles in cellular processes and disease pathways. This protein is implicated in various biological functions, including membrane biology, ion transport, and signal transduction, making it a candidate for studying various cellular mechanisms. Research has suggested that TMEM81 may be involved in modulating cellular responses to stress, influencing cellular proliferation and differentiation. Its expression pattern is notably varied across different tissues, hinting at specialized functions in particular cellular environments. Furthermore, emerging studies have proposed that aberrations in TMEM81 expression or function could be linked to several pathologies, including neurodegenerative diseases and certain cancers, which underscores its potential as a therapeutic target. Consequently, the generation of recombinant TMEM81 protein has become a crucial step in facilitating comprehensive studies of its structure, function, and interactions. By utilizing recombinant DNA technology, researchers can produce large quantities of purified TMEM81, enabling in-depth biochemical assays and structural analyses. Understanding its functional dynamics may provide insights into its role in health and disease, paving the way for potential clinical applications. The ongoing research into TMEM81 not only enhances our knowledge of membrane proteins but also opens new avenues for biomedicine, highlighting the importance of continued investigation into this enigmatic protein.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US