Analytical Data
-
Gene name
DPP9
- Application
-
Alternative Names
DPP9;DPRP2;Dipeptidyl peptidase 9
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86TI2
-
Expression Region
585-788aa
-
AA Sequence
LHKQPRFWASMMEAASCPPDYVPPEIFHFHTRSDVRLYGMIYKPHALQPGKKHPTVLFVYGGPQVQLVNNSFKGIKYLRLNTLASLGYAVVVIDGRGSCQRGLRFEGALKNQMGQVEIEDQVEGLQFVAEKYGFIDLSRVAIHGWSYGGFLSLMGLIHKPQVFKVAIAGAPVTVWMAYDTGYTERYMDVPENNQHGYEAGSVAL
-
Molecular Weight
29.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Dipeptidyl peptidase 9 (DPP9) is a member of the DPP enzyme family, primarily known for its role in the regulation of immune responses and metabolic processes. It is involved in the hydrolysis of dipeptides, particularly proline-containing peptides, and is critical for the processing and activation of various signaling molecules, including chemokines and cytokines. Dysregulation of DPP9 has been implicated in several pathological conditions, including autoimmune diseases, cancer, and metabolic disorders. Recent studies have highlighted its potential as a therapeutic target, leading to increased interest in the development of DPP9 recombinant proteins for research and clinical applications. The production of recombinant DPP9 allows for a better understanding of its structure-function relationship and facilitates the exploration of its role in disease mechanisms. Moreover, these recombinant proteins can be used in the development of inhibitors to modulate DPP9 activity, providing new avenues for therapeutic interventions. As such, the study of DPP9 and its recombinant forms is a dynamic area of research that holds promise for advancing our knowledge of immune regulation and for developing novel treatments for complex diseases.











