Analytical Data
-
Gene name
DPEP3
- Application
-
Alternative Names
DPEP3；Dipeptidase 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H4B8
-
Expression Region
36-463aa
-
AA Sequence
AETTPGAPRALSTLGSPSLFTTPGVPSALTTPGLTTPGTPKTLDLRGRAQALMRSFPLVDGHNDLPQVLRQRYKNVLQDVNLRNFSHGQTSLDRLRDGLVGAQFWSASVSCQSQDQTAVRLALEQIDLIHRMCASYSELELVTSAEGLNSSQKLACLIGVEGGHSLDSSLSVLRSFYVLGVRYLTLTFTCSTPWAESSTKFRHHMYTNVSGLTSFGEKVVEELNRLGMMIDLSYASDTLIRRVLEVSQAPVIFSHSAARAVCDNLLNVPDDILQLLKKNGGIVMVTLSMGVLQCNLLANVSTVADHFDHIRAVIGSEFIGIGGNYDGTGRFPQGLEDVSTYPVLIEELLSRSWSEEELQGVLRGNLLRVFRQVEKVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRVPWRS
-
Molecular Weight
48.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DPEP3, or dipeptidase 3, is a member of the glutamate carboxypeptidase family that plays a crucial role in peptide metabolism, particularly in the hydrolysis of dipeptides. It has garnered attention due to its potential implications in various physiological processes and diseases. Previous research has illuminated its involvement in the central nervous system, where it may participate in regulating neuropeptide levels and subsequently influence neuronal communication and behavior. Additionally, DPEP3 has been linked to metabolic pathways and has shown potential relevance in conditions such as obesity and diabetes. The study of DPEP3 is further motivated by its expression patterns in various tissues, suggesting diverse biological functions. The recombinant expression of DPEP3 allows for in-depth investigation into its enzymatic properties, substrate specificity, and structural characteristics, paving the way for potential therapeutic applications. Understanding the molecular mechanisms underlying DPEP3's functions can provide valuable insights into its role in health and disease, making it a target of interest in biomedical research. As the field progresses, elucidating the precise mechanisms of DPEP3 and its interactions within biological systems may contribute to the development of novel strategies for disease intervention and treatment.
