Analytical Data
-
Gene name
DGAT1
- Application
-
Alternative Names
DGAT1;AGRP1;DGAT;Diacylglycerol O-acyltransferase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75907
-
Expression Region
240-488aa
-
AA Sequence
TVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA
-
Molecular Weight
37.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DGAT1 (diacylglycerol O-acyltransferase 1) is a key enzyme involved in triglyceride biosynthesis, playing a crucial role in lipid metabolism and energy storage. It catalyzes the final step in the conversion of diacylglycerol and acyl-CoA into triacylglycerol, a process vital for maintaining cellular lipid homeostasis. Dysregulation of DGAT1 activity has been implicated in various metabolic disorders, including obesity, insulin resistance, and non-alcoholic fatty liver disease (NAFLD). Given its importance in lipid metabolism, DGAT1 has emerged as a promising therapeutic target for the treatment of metabolic diseases. Research on recombinant DGAT1 protein has focused on elucidating its structure, function, and regulatory mechanisms. The production of this enzyme in a recombinant form allows for detailed biochemical studies, including characterization of its catalytic activity and interaction with various substrates and inhibitors. Moreover, this research has provided insights into the enzyme's role in lipid droplet formation and its potential effects on systemic lipid levels. Understanding DGAT1's functionality and regulation is critical for developing targeted therapies aimed at modulating its activity to treat metabolic disorders effectively, highlighting the significance of DGAT1 recombinant protein studies in both basic research and clinical applications.











