Cat: PA1000-8302

Recombinant Human DGAT1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DGAT1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DGAT1;AGRP1;DGAT;Diacylglycerol O-acyltransferase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75907

  • Expression Region

    240-488aa

  • AA Sequence

    TVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAPAAEA

  • Molecular Weight

    37.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DGAT1 (diacylglycerol O-acyltransferase 1) is a key enzyme involved in triglyceride biosynthesis, playing a crucial role in lipid metabolism and energy storage. It catalyzes the final step in the conversion of diacylglycerol and acyl-CoA into triacylglycerol, a process vital for maintaining cellular lipid homeostasis. Dysregulation of DGAT1 activity has been implicated in various metabolic disorders, including obesity, insulin resistance, and non-alcoholic fatty liver disease (NAFLD). Given its importance in lipid metabolism, DGAT1 has emerged as a promising therapeutic target for the treatment of metabolic diseases. Research on recombinant DGAT1 protein has focused on elucidating its structure, function, and regulatory mechanisms. The production of this enzyme in a recombinant form allows for detailed biochemical studies, including characterization of its catalytic activity and interaction with various substrates and inhibitors. Moreover, this research has provided insights into the enzyme's role in lipid droplet formation and its potential effects on systemic lipid levels. Understanding DGAT1's functionality and regulation is critical for developing targeted therapies aimed at modulating its activity to treat metabolic disorders effectively, highlighting the significance of DGAT1 recombinant protein studies in both basic research and clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US