Analytical Data
-
Gene name
TMEM68
- Application
-
Alternative Names
TMEM68; Transmembrane Protein 68
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96MH6
-
Expression Region
1-135 aa
-
AA Sequence
MIDKNQTCGVGQDSVPYMICLIHILEEWFGVEQLEDYLNFANYLLWVFTPLILLILPYFTIFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGKQGYFHLCVAIHVCCIGTVLPFHFID
-
Molecular Weight
42.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM68 (Transmembrane Protein 68) has emerged as a significant focus within the field of molecular biology and biochemistry due to its potential role in various cellular processes. Initially identified through genomic studies, TMEM68 belongs to a larger family of transmembrane proteins that are implicated in cellular signaling and membrane trafficking. Research has indicated that TMEM68 is involved in regulating intracellular calcium levels and may participate in cellular responses to stress. Its expression patterns have been linked to certain diseases, including neurodegenerative disorders and cancer, highlighting its potential as a biomarker or therapeutic target. Recombinant TMEM68 protein production has enabled scientists to explore its functional properties and interactions at a molecular level. Investigating the structure, function, and molecular mechanisms of TMEM68 through recombinant protein techniques can provide invaluable insights into its role in health and disease. This research is crucial for developing targeted therapies and understanding the underlying biology that governs cellular homeostasis and pathology. Overall, the study of TMEM68 and its recombinant protein forms stands to make significant contributions to our understanding of fundamental biological processes and their implications in medicine.
