Analytical Data
-
Gene name
ETV2
- Application
-
Alternative Names
ETV2; ER71; ETSRP71ETS translocation variant 2; Ets-related protein 71
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O00321
-
Expression Region
1-342aa
-
AA Sequence
MDLWNWDEASPQEVPPGNKLAGLEGAKLGFCFPDLALQGDTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSGDWTDMACTAWDSWSGASQTLGPAPLGPGPIPAAGSEGAAGQNCVPVAGEATSWSRAQAAGSNTSWDCSVGPDGDTYWGSGLGGEPRTDCTISWGGPAGPDCTTSWNPGLHAGGTTSLKRYQSSALTVCSEPSPQSDRASLARCPKTNHRGPIQLWQFLLELLHDGARSSCIRWTGNSREFQLCDPKEVARLWGERKRKPGMNYEKLSRGLRYYYRRDIVRKSGGRKYTYRFGGRVPSLAYPDCAGGGRGAETQ
-
Molecular Weight
64.02 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the ETV2 (ETS Variant 2) recombinant protein has gained significant attention in the fields of developmental biology and regenerative medicine due to its crucial role in endothelial cell development and vasculogenesis. ETV2 is a member of the ETS transcription factor family, which is involved in regulating gene expression during embryonic development, particularly in the formation of blood vessels. Research has shown that ETV2 is pivotal for the differentiation of pluripotent stem cells into endothelial progenitors, making it a key target for therapeutic applications in conditions like ischemic diseases and vascular disorders. The ability to manipulate ETV2 expression and protein activity may enhance the efficiency of generating vascular tissues in vitro, thus addressing limitations in tissue engineering and transplantation. Furthermore, understanding the molecular mechanisms behind ETV2’s function could lead to novel approaches for promoting angiogenesis in damaged tissues. This research area is expanding, exploring the potential of ETV2 in combination with other signaling pathways and transcription factors to refine and optimize strategies for vascular regeneration. Overall, the investigation of ETV2 recombinant protein not only enriches our understanding of vascular biology but also holds promise for advancing clinical applications in regenerative medicine.
