Analytical Data
-
Gene name
TMEM64
- Application
-
Alternative Names
TMEM64; Transmembrane Protein 64
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6YI46
-
Expression Region
1-186 aa
-
AA Sequence
MGLMMVGVLIGTFIAHVVCKRLLTAWVAARIQSSEKLSAVIRVVEGGSGLKVVALARLTPIPFGLQNAVFSITDLSLPNYLMASSVGLLPTQLLNSYLGTTLRTMEDVIAEQSVSGYFVFCLQIIISIGLMFYVVHRAQVELNAAIVACEMELKSSLVKGNQPNTSGSSFYNKRTLTFSGGGINVV
-
Molecular Weight
46.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM64, a transmembrane protein, has garnered attention in recent years due to its potential roles in cellular processes and disease mechanisms. Research indicates that TMEM64 is involved in regulating various physiological functions, including cell proliferation, apoptosis, and possibly calcium homeostasis. Emerging evidence suggests that dysregulation of TMEM64 expression may be linked to several pathological conditions, including cancer and neurodegenerative diseases. The characterization of TMEM64 as a recombinant protein has become a focal point for scientists seeking to understand its structure-function relationship and its interactions with other cellular components. By producing TMEM64 as a recombinant protein, researchers can obtain large quantities for biochemical assays, enabling investigations into its molecular mechanisms. Such studies may reveal TMEM64's role in cellular signaling pathways and its broader implications in disease contexts. Furthermore, understanding TMEM64's function could pave the way for the development of novel therapeutic strategies targeting its pathways in various diseases. Overall, the study of TMEM64 as a recombinant protein is crucial for elucidating its biological significance and potential as a biomarker or therapeutic target in human health and disease.
