Analytical Data
-
Gene name
TMEM54
- Application
-
Alternative Names
TMEM54; BCLP; CAC1; Transmembrane Protein 54; Beta-casein-like Protein; Protein CAC-1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q969K7
-
Expression Region
1-169 aa
-
AA Sequence
MCLRLGGLSVGDFRKVLMKTGLVLVVLGHVSFITAALFHGTVLRYVGTPQDAVALQYCVVNILSVTSAIVGKALLAACTFGSSELLALAPDCPFDPTRIYSSSLCLWGIALVLCVAENVFAVRCAQLTHQLLELRPWWGKSSHHMMRENPELVEGRDLLSCTSSEPLTL
-
Molecular Weight
44.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM54, or Transmembrane Protein 54, is an intriguing candidate in the study of membrane proteins due to its potential roles in cellular signaling and membrane dynamics. Research surrounding TMEM54 has gained traction given its suspected involvement in various physiological processes and disease states, including neurodegenerative disorders and cancer. The protein's particular structure, characterized by multiple transmembrane domains, raises questions about its functional mechanisms and interactions within the cellular environment. Recombining TMEM54 for research purposes allows scientists to delve deeper into its molecular properties, offering insights into its role in cellular homeostasis and the implications of its dysfunction. By producing recombinant TMEM54, researchers aim to elucidate its binding partners, cellular localization, and potential pathways it may influence. This protein provides a critical opportunity to advance the understanding of membrane protein functions and their broader implications in health and disease, paving the way for novel therapeutic strategies that target TMEM54-related pathways. As such, studies focusing on TMEM54 and its recombinant forms are essential for grasping the complexities of membrane biology and its impact on overall cellular health.
