Analytical Data
-
Gene name
ETV1
- Application
-
Alternative Names
DKFZp781L0674; ER81; ER81 protein; ER81; mouse; homolog of; ETS translocation variant 1; ets variant gene 1; Ets-related protein 81; Etsrp81; ETV 1; ETV1; ETV1_HUMAN; MGC104699; MGC120533; MGC120534
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50549
-
Expression Region
1-477aa
-
AA Sequence
MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAEAQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYNVSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQFYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSNSHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEALFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY
-
Molecular Weight
52.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ETV1 is an ETS transcription factor that has gained significant attention due to its role in various biological processes and its implications in cancer research. This protein is involved in regulating gene expression related to developmental processes and cell differentiation. Notably, ETV1 is often found to be overexpressed in several types of cancers, including prostate cancer, suggesting that it plays a critical role in tumorigenesis and cancer progression. Researchers have focused on characterizing ETV1, understanding its molecular mechanisms, and exploring its potential as a therapeutic target. The recombinant production of ETV1 enables scientists to study its structure, function, and interactions with other proteins in detail. By generating ETV1 in a laboratory setting, researchers can investigate how this protein contributes to oncogenic pathways and evaluate the efficacy of ETV1 inhibitors in preclinical models. The study of ETV1 not only enhances our understanding of its biological roles but also opens avenues for developing novel cancer therapies that specifically target this transcription factor or its downstream effects, thereby offering hope for more effective treatment strategies for patients with ETV1-related malignancies.
