Analytical Data
-
Gene name
TMEM134
- Application
-
Alternative Names
TMEM134; Transmembrane Protein 134
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H6X4
-
Expression Region
1-195 aa
-
AA Sequence
MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVVLASFLLLLLGLVLILVGVGLEATPSPGVSSAIFFVPGFLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYFEK
-
Molecular Weight
48 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM134, or Transmembrane Protein 134, is a member of the transmembrane protein family that has garnered significant interest in biomedical research due to its potential roles in cellular processes and disease mechanisms. Initially implicated in the regulation of membrane dynamics and cellular signaling, TMEM134's precise functions in various physiological and pathological contexts remain largely unexplored. Recent studies suggest that TMEM134 is involved in endoplasmic reticulum (ER) stress response and may contribute to the modulation of immune responses. Its expression has been observed in multiple tissues, hinting at a potential role in diverse biological functions, from development to immune system regulation. Moreover, aberrations in TMEM134 expression have been associated with several diseases, including cancer and autoimmune disorders, highlighting its importance as a potential biomarker and therapeutic target. The production of recombinant TMEM134 protein has become crucial for understanding its structure-function relationships and for exploring its interactions with other cellular components. Advances in protein engineering and expression systems enable researchers to obtain this protein in sufficient quantities for functional assays, paving the way for further investigation into its biological significance and therapeutic potential. As the field progresses, elucidating the role of TMEM134 in cellular homeostasis and disease will enhance our understanding of its contributions to human health, providing new avenues for intervention in diseases linked to its dysregulation.
