Analytical Data
-
Gene name
EPN2
- Application
-
Alternative Names
EHB21; EPN 2; Epn2; EPN2_HUMAN; EPS 15 interacting protein 2; EPS-15-interacting protein 2; Eps15 binding protein; Epsin 2; Epsin-2; Epsin2; KIAA1065
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95208
-
Expression Region
1-584aa
-
AA Sequence
MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTSHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLRRGDDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPSASTNQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATAQSVPKNSDPWAASQQPASSAGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQNNGTTSPDPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFLAPGAPATSAPVNPFQVNQPQPLTLNQLRGSPVLGTSTSFGPGPGVESMAVASMTSAAPQPALGATGSSLTPLGPAMMNMVGSVGIPPSAAQATGTTNPFLL
-
Molecular Weight
88.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EPN2, also known as Epsin 2, is an important protein implicated in various cellular processes, including endocytosis, membrane trafficking, and the regulation of cellular signaling pathways. Research on EPN2 has gained momentum due to its role in mediating the internalization of membrane proteins and its involvement in the formation of clathrin-coated vesicles, which are essential for cellular uptake of nutrients and signaling molecules. Dysregulation of EPN2 has been linked to various diseases, including cancer and neurodegenerative disorders, suggesting its potential as a therapeutic target. Recent studies aim to elucidate the structural dynamics of EPN2 and how its interactions with other proteins contribute to cellular functions. Understanding the biochemical pathways influenced by EPN2 can shed light on the underlying mechanisms of its involvement in disease progression and offer insights into new treatment strategies. Researchers are employing advanced techniques such as X-ray crystallography, cryo-electron microscopy, and fluorescence resonance energy transfer to investigate the molecular details of EPN2 function, providing a promising avenue to enhance our understanding of cellular biology and the development of targeted therapies.
