Analytical Data
-
Gene name
TMEM126B
- Application
-
Alternative Names
TMEM126B; HT007; Complex I assembly factor TMEM126B. mitochondrial; Transmembrane Protein 126B
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IUX1
-
Expression Region
1-200 aa
-
AA Sequence
MAASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTTAGFSGIFSNFLFRRCFKVKHDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENCVFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCQTQMKLMAIPLVFQIMFGILNGLYHYAVFEETLEKTIHEE
-
Molecular Weight
49.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM126B, a member of the transmembrane protein family, has garnered attention in recent years due to its potential roles in various cellular processes. It is implicated in mitochondrial dynamics, including fusion and fission, which are critical for maintaining mitochondrial function and cellular homeostasis. Dysregulation of these processes is associated with several diseases, including neurodegenerative disorders and metabolic syndromes. Furthermore, studies have indicated that TMEM126B may participate in signaling pathways that affect cell survival and apoptosis. Research efforts have focused on the recombinant expression and purification of TMEM126B to elucidate its structure-function relationships and to explore its interactions with other cellular components. The generation of recombinant TMEM126B protein allows for in-depth biochemical and biophysical analyses, providing insights into its mechanistic roles in mitochondrial biology. Understanding TMEM126B's function could reveal new therapeutic targets for diseases linked to mitochondrial dysfunction. Overall, the study of TMEM126B and its recombinant protein holds promise for advancing our knowledge of cellular processes and developing novel strategies for disease intervention.
