Analytical Data
-
Gene name
ZNF134
- Application
-
Alternative Names
MGC138499; MGC141970; pHZ 15; pHZ15; Zinc finger Protein 134; ZN134_HUMAN; ZNF 134; ZNF134
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52741
-
Expression Region
1-427 aa
-
AA Sequence
MTLVTAGGAWTGPGCWHEVKDEESSSEQSISIAVSHVNTSKAGLPAQTALPCDICGPILK DILHLDEHQGTHHGLKLHTCGACGRQFWFSANLHQYQKCYSIEQPLRRDKSEASIVKNCT VSKEPHPSEKPFTCKEEQKNFQATLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSE CGKAFSRKDTLVQHQRIHSGEKPYECSECGKAFSRKATLVQHQRIHTGERPYECSECGKT FSRKDNLTQHKRIHTGEMPYKCNECGKYFSHHSNLIVHQRVHNGARPYKCSDCGKVFRHK STLVQHESIHTGENPYDCSDCGKSFGHKYTLIKHQRIHTESKPFECIECGKFFSRSSDYI AHQRVHTGERPFVCSKCGKDFIRTSHLVRHQRVHTGERPYECSECGKAYSLSSHLNRHQK VHTAGRL
-
Molecular Weight
48.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF134, or Zinc Finger Protein 134, is a member of the zinc finger protein family, which plays a crucial role in various biological processes, including gene regulation, cellular differentiation, and development. This protein is characterized by its zinc finger motifs, which enable it to interact with DNA and other proteins, thereby influencing transcriptional activity. Research on ZNF134 has gained attention due to its potential involvement in critical pathways related to cancer, neurological disorders, and developmental abnormalities. The understanding of ZNF134's functional mechanisms and its interactions with other molecular components is essential for unraveling its biological significance. Recombinant ZNF134 protein production has become a focal point in studies aimed at elucidating its structure-function relationships. By generating ZNF134 in a recombinant form, researchers can investigate its biochemical properties, explore its role in regulating gene expression, and assess its potential as a therapeutic target. Furthermore, the study of ZNF134 might provide insights into the mechanisms of diseases associated with its dysregulation, thereby offering opportunities for developing novel treatment strategies. Overall, the research on recombinant ZNF134 proteins is poised to enhance our understanding of its biological roles and implications in health and disease.
