Analytical Data
-
Gene name
TMED9
- Application
-
Alternative Names
TMED9; GP25L2; Transmembrane emp24 domain-containing Protein 9; GMP25; GlycoProtein 25L2; p24 family Protein alpha-2; p24alpha2; p25
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BVK6
-
Expression Region
1-235 aa
-
AA Sequence
MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRHLKSFFEAKKLV
-
Molecular Weight
53.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMED9, a member of the TMED protein family, plays a crucial role in protein trafficking and sorting within the cell’s endoplasmic reticulum (ER) and Golgi apparatus. As a transporter protein, it is involved in the maturation and processing of glycoproteins, influencing their eventual delivery to the plasma membrane or secretion outside the cell. Research into TMED9 has gained momentum due to its potential implications in various diseases, including cancer, where aberrant protein trafficking may contribute to tumor progression and metastasis. Additionally, TMED9 has been linked to neurodegenerative disorders, indicating its significance in maintaining cellular homeostasis. The production of recombinant TMED9 protein allows for in-depth studies of its structural and functional properties, facilitating the exploration of its role in protein transport mechanisms. Understanding TMED9's interactions with other cellular components can provide insights into the underlying pathways that govern cellular function and highlight potential therapeutic targets. Enhanced knowledge of TMED9 may also pave the way for innovative strategies in drug delivery and therapeutic interventions, particularly in diseases characterized by protein misfolding or improper trafficking. Thus, the study of TMED9 recombinant protein holds great promise in advancing our understanding of cell biology and developing novel treatments for various pathologies.
