Cat: PA2000-7378

Recombinant Human EPHA5 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EPHA5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Brain-specific kinase; bsk; CEK 7; Eck like sequence 1; EHK 1; EHK-1; EK7; Els 1; EPH homology kinase 1; EPH-like kinase 7; EPHA5; EPHA5_HUMAN; Ephrin type A receptor 5; Ephrin type-A receptor 5; HEK 7; hEK7; Receptor protein tyrosine kinase HEK 7; Rek 7; TYRO 4; Tyrosine protein kinase receptor EHK 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P54756

  • Expression Region

    595-1037aa

  • AA Sequence

    SGSCCECGCGRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGMLRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAALYQLMLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHSPLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIMNSLQEMKVQLVNGMVPL

  • Molecular Weight

    80.68 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Ephrin type-A receptor 5 (EPHA5) is a member of the Eph receptor family, which plays a crucial role in cell signaling and communication, particularly in the context of neuronal development and tissue organization. As a receptor tyrosine kinase, EPHA5 has been implicated in various physiological processes, including synaptic plasticity, neural cell migration, and angiogenesis. Dysregulation of EPHA5 has been associated with several pathological conditions, such as cancer and neurodegenerative diseases. The production of recombinant EPHA5 proteins has become essential for studying its biological functions and interactions with ephrin ligands. By generating and purifying EPHA5 in a controlled laboratory environment, researchers can explore its signaling pathways, investigate its role in disease mechanisms, and evaluate its potential as a therapeutic target. Moreover, understanding the structure-function relationship of EPHA5 through recombinant protein studies can provide insights into its ligand-binding properties and downstream signaling cascades. This research has significant implications for developing strategies to modulate EPHA5 activity, which could lead to novel treatments for diseases where EPHA5 is involved. Overall, the study of recombinant EPHA5 proteins is a pivotal step in elucidating the complex functions of this receptor and its impact on health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US