Analytical Data
-
Gene name
EPHA5
- Application
-
Alternative Names
Brain-specific kinase; bsk; CEK 7; Eck like sequence 1; EHK 1; EHK-1; EK7; Els 1; EPH homology kinase 1; EPH-like kinase 7; EPHA5; EPHA5_HUMAN; Ephrin type A receptor 5; Ephrin type-A receptor 5; HEK 7; hEK7; Receptor protein tyrosine kinase HEK 7; Rek 7; TYRO 4; Tyrosine protein kinase receptor EHK 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54756
-
Expression Region
595-1037aa
-
AA Sequence
SGSCCECGCGRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDPNQAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVGMLRGISAGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPSPMDCPAALYQLMLDCWQKERNSRPKFDEIVNMLDKLIRNPSSLKTLVNASCRVSNLLAEHSPLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKIMNSLQEMKVQLVNGMVPL
-
Molecular Weight
80.68 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ephrin type-A receptor 5 (EPHA5) is a member of the Eph receptor family, which plays a crucial role in cell signaling and communication, particularly in the context of neuronal development and tissue organization. As a receptor tyrosine kinase, EPHA5 has been implicated in various physiological processes, including synaptic plasticity, neural cell migration, and angiogenesis. Dysregulation of EPHA5 has been associated with several pathological conditions, such as cancer and neurodegenerative diseases. The production of recombinant EPHA5 proteins has become essential for studying its biological functions and interactions with ephrin ligands. By generating and purifying EPHA5 in a controlled laboratory environment, researchers can explore its signaling pathways, investigate its role in disease mechanisms, and evaluate its potential as a therapeutic target. Moreover, understanding the structure-function relationship of EPHA5 through recombinant protein studies can provide insights into its ligand-binding properties and downstream signaling cascades. This research has significant implications for developing strategies to modulate EPHA5 activity, which could lead to novel treatments for diseases where EPHA5 is involved. Overall, the study of recombinant EPHA5 proteins is a pivotal step in elucidating the complex functions of this receptor and its impact on health and disease.
