Analytical Data
-
Gene name
ZNF133
- Application
-
Alternative Names
pHZ 13; pHZ 66; Zinc finger Protein 133 (clone pHZ13); Zinc finger Protein 133; Zinc finger Protein 150 (pHZ66); Zinc finger Protein 150; ZN133_HUMAN; ZNF133; ZNF150
-
Species
Human
-
Source
E. coli
-
Tag
His-DHFR tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52736
-
Expression Region
388-635 aa
-
AA Sequence
CGRCFRQRTTLVNHQRTHSKEKPYVCGVCGHSFSQNSTLISHRRTHTGEKPYVCGVCGRGFSLKSHLNRHQNIHSGEKPIVCKDCGRGFSQQSNLIRHQRTHSGEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCRECGRGFSHQAGLIRHKRKHSREKPYMCRQCGLGFGNKSALITHKRAHSEEKPCVCRECGQGFLQKSHLTLHQMTHTGEKPYVCKTCGRGFSLKSHLSRHRKTTSVHHRLP
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZNF133, a member of the zinc finger protein family, is increasingly recognized for its potential role in various biological processes, including gene regulation, cell differentiation, and proliferation. Abnormal expression of ZNF133 has been implicated in several diseases, particularly cancer, where it may function as a tumor suppressor or oncogene depending on the context. Understanding the mechanisms behind ZNF133's function is crucial for elucidating its role in cellular dynamics and disease pathology. Recombinant ZNF133 protein has become a valuable tool in research, allowing scientists to study its structural and functional properties in vitro. By producing this protein in heterologous systems, researchers can investigate its interactions with DNA and other proteins, facilitating insights into its regulatory mechanisms. Additionally, exploring the post-translational modifications of ZNF133 can reveal how its activity is modulated under different physiological conditions. Overall, the study of recombinant ZNF133 not only enhances our understanding of zinc finger proteins but also opens new avenues for therapeutic interventions targeting related diseases.
