Cat: PAX2000-12002

Recombinant Human TMED6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TMED6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TMED6; UNQ9146/PRO34237; Transmembrane emp24 domain-containing Protein 6; p24 family Protein gamma-5; p24gamma5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8WW62

  • Expression Region

    1-240 aa

  • AA Sequence

    MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSCEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRC

  • Molecular Weight

    54 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TMED6, a member of the transmembrane emp24 domain (TMED) protein family, plays a crucial role in the endoplasmic reticulum (ER) to Golgi transport pathway, facilitating the movement of proteins within the secretory pathway. Research on TMED6 has gained prominence due to its involvement in various cellular processes, including glycosylation, protein sorting, and the maintenance of ER homeostasis. Recent studies have suggested that TMED6 also participates in regulating cellular stress responses and modulating immune functions, thus linking it to several disease states, such as cancer and neurodegenerative disorders. The importance of TMED6 in cellular biology, particularly in membrane trafficking and organelle interaction, makes it an attractive target for further investigation. Understanding its structure and function through recombinant protein studies can provide insights into its mechanistic roles, potentially uncovering new therapeutic approaches for diseases where TMED6 is implicated. Moreover, the development of TMED6 recombinant proteins enables the exploration of its interactions with other cellular components and aids in the elucidation of its function in health and disease. Overall, the research on TMED6 recombinant protein serves as a stepping stone towards deciphering its biological significance and therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US