Analytical Data
-
Gene name
TMED6
- Application
-
Alternative Names
TMED6; UNQ9146/PRO34237; Transmembrane emp24 domain-containing Protein 6; p24 family Protein gamma-5; p24gamma5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WW62
-
Expression Region
1-240 aa
-
AA Sequence
MSPLLFGAGLVVLNLVTSARSQKTEPLSGSGDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSCEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKVQNNIFHMWRYYNFARMRKMADFFLIQSNYNYVNWWSTAQSLVIILSGILQLYFLKRLFNVPTTTDTKKPRC
-
Molecular Weight
54 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMED6, a member of the transmembrane emp24 domain (TMED) protein family, plays a crucial role in the endoplasmic reticulum (ER) to Golgi transport pathway, facilitating the movement of proteins within the secretory pathway. Research on TMED6 has gained prominence due to its involvement in various cellular processes, including glycosylation, protein sorting, and the maintenance of ER homeostasis. Recent studies have suggested that TMED6 also participates in regulating cellular stress responses and modulating immune functions, thus linking it to several disease states, such as cancer and neurodegenerative disorders. The importance of TMED6 in cellular biology, particularly in membrane trafficking and organelle interaction, makes it an attractive target for further investigation. Understanding its structure and function through recombinant protein studies can provide insights into its mechanistic roles, potentially uncovering new therapeutic approaches for diseases where TMED6 is implicated. Moreover, the development of TMED6 recombinant proteins enables the exploration of its interactions with other cellular components and aids in the elucidation of its function in health and disease. Overall, the research on TMED6 recombinant protein serves as a stepping stone towards deciphering its biological significance and therapeutic potential.
