Analytical Data
-
Gene name
PAR1
- Application
-
Alternative Names
PAR1；CF2R；PAR1；TR；Proteinase-activated receptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25116
-
Expression Region
42-102aa
-
AA Sequence
SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISED ASGYLTSSWLT
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PAR1 (protease-activated receptor 1) is a member of the G protein-coupled receptor family and plays a crucial role in various physiological and pathological processes, including hemostasis, inflammation, and cancer. Activated by thrombin, PAR1 undergoes a unique proteolytic cleavage that exposes a tethered ligand, leading to the initiation of several intracellular signaling cascades. This receptor has garnered significant attention due to its involvement in thrombotic disorders and its potential as a therapeutic target in cardiovascular diseases and cancer therapies. Research has revealed that PAR1 is not only implicated in platelet activation and blood clotting but also influences cellular responses relating to angiogenesis, cell migration, and tumor metastasis. Moreover, studies have shown that dysregulation of PAR1 activity can contribute to conditions such as atherosclerosis and other inflammatory diseases. Consequently, the development of PAR1 recombinant proteins for research and therapeutic applications has become increasingly important. These recombinant proteins facilitate the study of PAR1's structure-function relationships and enable the discovery of novel pharmacological agents that modulate its activity. Understanding PAR1 signaling could advance the design of targeted therapies that mitigate its pathological effects while harnessing its beneficial roles in tissue repair and immune responses. Overall, the ongoing research on PAR1 recombinant proteins is paving the way for innovative treatment strategies, enhancing our understanding of receptor biology, and offering insights into the interconnected mechanisms underlying various diseases.
