Analytical Data
-
Gene name
ZMYND8
- Application
-
Alternative Names
ZMYND8; KIAA1125; PRKCBP1; RACK7; Protein kinase C-binding Protein 1; Cutaneous T-cell lymphoma-associated antigen se14-3; CTCL-associated antigen se14-3; Rack7; Zinc finger MYND domain-containing Protein 8
-
Species
Human
-
Source
E. coli
-
Tag
GST tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9ULU4
-
Expression Region
160-280 aa
-
AA Sequence
MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGL EFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVL DIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTH PDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIA WPLQGWQATFGGGDHPPKSDLEVLFQGPLGSETQSKAMTMLTIEQLSYLL KFAIQKMKQPGTDAFQKPVPLEQHPDYAEYIFHPMDLCTLEKNAKKKMYG CTEAFLADAKWILHNCIIYNGGNHKLTQIAKVVIKICEHEMNEIEVCPEC YL
-
Molecular Weight
41 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZMYND8 is a zinc finger protein that plays a crucial role in regulating gene expression and chromatin remodeling. It has garnered significant research interest due to its involvement in various cellular processes, including DNA damage response, transcriptional regulation, and cancer progression. Studies have shown that ZMYND8 interacts with several key molecular pathways that are critical for maintaining genomic stability and facilitating cellular responses to stress. Researchers have reported its overexpression in certain tumor types, suggesting a potential oncogenic role. This has prompted investigations into ZMYND8 as a potential therapeutic target or biomarker for cancer diagnosis and treatment. Additionally, understanding its structural characteristics and functional mechanisms is essential for elucidating its role in other biological contexts, such as stem cell biology and development. The recombination and expression of ZMYND8 protein in vitro allow for detailed studies into its interactions with other proteins and nucleic acids, enabling researchers to explore its contributions to health and disease comprehensively. Given its multifaceted functions and implications in oncogenesis, ZMYND8 continues to be a focal point for studies aiming to unravel the complexities of gene regulation and the molecular underpinnings of cancer.
