Analytical Data
-
Gene name
ZMYM6
- Application
-
Alternative Names
ZMYM6; Buster2; KIAA1353; ZNF258Zinc finger MYM-type Protein 6; Transposon-derived Buster2 transposase-like Protein; Zinc finger Protein 258
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95789
-
Expression Region
1-156 aa
-
AA Sequence
MKEPLDGECGKAVVPQQELLDKIKEEPDNAQEYGCVQQPKTQESKLKIGGVSSVNERPIAQQLNPGFQLSFASSGPSVLLPSVPAVAIKVFCSGCKKMLYKGQTAYHKTGSTQLFCSTRCITRHSSPACLPPPPKKTCTNCSKYKILNIPFYFTFF
-
Molecular Weight
42.79 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZMYM6, a member of the ZMYM protein family, has garnered attention in recent years due to its potential role in various biological processes, particularly in gene regulation and chromatin remodeling. This protein, known for its multiple ZZ-type zinc finger domains, is involved in the interaction with nucleic acids and protein complexes, which suggests its significance in transcriptional regulation and potentially in DNA repair mechanisms. Emerging research indicates that ZMYM6 may play a crucial role in the development of certain cancers, as its expression levels have been correlated with tumor progression and metastasis. Additionally, ZMYM6 is thought to participate in the cellular response to stress, further emphasizing its importance in maintaining cellular homeostasis. Investigating ZMYM6's functions and interactions could provide insights into the molecular underpinnings of oncogenesis and highlight new therapeutic targets. Recent advances in proteomics and molecular biology techniques have facilitated the exploration of ZMYM6's structure and function, paving the way for deeper understanding of its biological relevance and potential implications in disease contexts. Insights gained from these studies could contribute to the development of strategies aimed at modulation of ZMYM6 activity in therapeutic applications, especially in the context of cancer treatment, making it a protein of considerable interest in the field of molecular biology and oncology.
