Analytical Data
-
Gene name
LRP2
- Application
-
Alternative Names
LRP2；Low-density lipoProtein receptor-related Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P98164
-
Expression Region
1186-1389aa
-
AA Sequence
NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE
-
Molecular Weight
50.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LRP2 (low-density lipoprotein receptor-related protein 2) is a multi-functional membrane receptor that plays a crucial role in various biological processes, including endocytosis, signaling, and cellular transport. It has garnered considerable attention in recent years due to its involvement in several pathophysiological conditions, such as neurodegenerative diseases and developmental disorders. The study of LRP2 has been significantly aided by the development of recombinant proteins, which facilitate the investigation of its structure-function relationships and interaction dynamics with ligands and other cellular components. By generating and characterizing LRP2 recombinant proteins, researchers aim to elucidate its regulatory mechanisms, explore its potential as a therapeutic target, and understand its role in cellular homeostasis. This research holds promise not only for advancing our understanding of LRP2's biological significance but also for developing novel interventions in diseases where LRP2 dysfunction is implicated. Thus, the ongoing studies on LRP2 recombinant proteins represent a critical avenue of exploration in molecular biology and therapeutic development.
