Analytical Data
-
Gene name
LRP1
- Application
-
Alternative Names
LRP1；A2MR；APR；Prolow-density lipoProtein receptor-related Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07954-2
-
Expression Region
1-292aa
-
AA Sequence
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGE RDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMD GSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKD FDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPV LLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDS AAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
-
Molecular Weight
58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LRP1 (Low-Density Lipoprotein Receptor-Related Protein 1) is a multi-functional receptor that plays critical roles in lipid metabolism, neurobiology, and cellular signaling. It is involved in the endocytosis of various ligands, influencing cholesterol homeostasis and the clearance of amyloid-beta peptides, which are implicated in Alzheimer’s disease. The study of LRP1 has gained traction due to its potential therapeutic implications in treating neurodegenerative disorders and cardiovascular diseases. Recent advancements in recombinant protein technology have enabled the production of LRP1 in various expression systems, allowing researchers to investigate its structural and functional properties in detail. This includes understanding the receptor's interactions with lipoproteins, neurotransmitters, and other cellular partners, which is essential for deciphering its diverse biological roles. Additionally, the recombinant LRP1 protein can be used in the development of targeted drug delivery systems, diagnostics, and functional assays to explore the pathways regulated by this receptor. The ongoing research on LRP1 recombinant proteins aims not only to elucidate the molecular mechanisms underlying its functions but also to identify potential therapeutic targets for diseases linked to its dysregulation. Thus, LRP1 remains a significant focus of biomedical research, with the potential to contribute to the development of novel treatment strategies in metabolic and neurodegenerative disorders.
