Analytical Data
-
Gene name
TMBIM6
- Application
-
Alternative Names
TMBIM6; BI1; TEGT; Bax inhibitor 1; BI-1; Testis-enhanced gene transcript Protein; Transmembrane BAX inhibitor motif-containing Protein 6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55061
-
Expression Region
1-237 aa
-
AA Sequence
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMLVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMTFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK
-
Molecular Weight
51.81 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMBIM6, a member of the TMBIM (Transmembrane BAX Inhibitor Motif-containing) family, has gained significant attention in the field of cellular biology due to its role in modulating apoptosis and cellular stress responses. This protein is primarily localized in the endoplasmic reticulum (ER) and is implicated in maintaining cellular homeostasis under stressful conditions, such as oxidative stress and nutrient deprivation. Recent studies have suggested that TMBIM6 exerts its functions by regulating calcium homeostasis and influencing mitochondrial dynamics, ultimately affecting cell survival and death pathways. The interest in TMBIM6 is driven by its potential implications in various diseases, including neurodegenerative disorders and cancers, where dysregulation of apoptosis plays a critical role. Moreover, exploring TMBIM6 as a therapeutic target could provide novel strategies for disease intervention. Consequently, the recombinant expression of TMBIM6 facilitates in-depth investigation of its functional properties and interactions within cellular contexts, enabling a better understanding of its biological significance and therapeutic potential. Researchers aim to elucidate the mechanistic pathways involving TMBIM6, thereby contributing to the broader understanding of ER-mediated signaling and its impact on cell fate decisions in health and disease.
