Analytical Data
-
Gene name
TM9SF2
- Application
-
Alternative Names
p76; TM9S2_HUMAN; Tm9sf2; Transmembrane 9 superfamily member 2
-
Species
Human
-
Source
E.coli
-
Tag
N-terminal His and TRxA Tag
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99805
-
Expression Region
116-215 aa
-
AA Sequence
KKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITDKGHAKDACVISSDFHERDTFYIFNHVD IK
-
Molecular Weight
21.8kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
TM9SF2, a member of the transmembrane 9 superfamily, is an increasingly studied protein implicated in various cellular processes, including immune response and cell signaling. Research has shown that TM9SF2 plays a significant role in modulating the immune system, particularly in the activation and regulation of T cells. Its particular structure, characterized by multiple transmembrane domains, suggests that TM9SF2 may be involved in facilitating cell-cell interactions and signaling pathways. The recombinant expression of TM9SF2 in heterologous systems has become a key focus, as it allows for in-depth functional studies and structural characterization of the protein. Understanding TM9SF2's function is essential, as dysregulation of this protein has been linked to autoimmune diseases and other immune disorders. Moreover, the potential therapeutic implications of modulating TM9SF2 activity in various disease contexts make it a compelling target for further investigation. Ongoing research aims to elucidate the specific mechanisms of TM9SF2 action and its interactions with other signaling molecules within the immune system, thereby providing insights that may lead to novel therapeutic strategies.
