Analytical Data
-
Gene name
LRP3
- Application
-
Alternative Names
LRP3；Low-density lipoProtein receptor-related Protein 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07954-2
-
Expression Region
1-292aa
-
AA Sequence
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGE RDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMD GSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKD FDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPV LLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDS AAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
-
Molecular Weight
58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The NLRP3 (Nod-like receptor protein 3) is a key component of the innate immune system, primarily involved in the formation of the inflammasome, a multi-protein complex that activates pro-inflammatory cytokines such as IL-1β and IL-18. Dysregulation of NLRP3 has been implicated in various inflammatory diseases, including autoimmune disorders, metabolic syndromes, and neurodegenerative diseases. With increasing recognition of its role in health and disease, there is a growing interest in the study of recombinant NLRP3 protein to elucidate its structural and functional properties. Recombinant NLRP3 allows for detailed investigation of its mechanisms of action, interactions with other inflammasome components, and its modulation by different stimuli. Moreover, the production of recombinant NLRP3 protein provides a valuable tool for the development of therapeutic strategies, targeting NLRP3 activation as a means to alleviate chronic inflammation. Understanding the precise role of NLRP3 in various pathological contexts could lead to novel diagnostic and therapeutic approaches, making the research on recombinant NLRP3 a pivotal area in immunology and drug development.
