Analytical Data
-
Gene name
ZMPSTE24
- Application
-
Alternative Names
ZMPSTE24; FACE1; STE24; CAAX prenyl protease 1 homolog; Farnesylated Proteins-converting enzyme 1; FACE-1; Prenyl Protein-specific endoprotease 1; Zinc metalloProteinase Ste24 homolog
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75844
-
Expression Region
1-475 aa
-
AA Sequence
MGMWASLDALWEMPAEKRIFGAVLLFSWTVYLWETFLAQRQRRIYKTTTHVPPELGQIMDSETFEKSRLYQLDKSTFSFWSGLYSETEGTLILLFGGIPYLWRLSGRFCGYAGFGPEYEITQSLVFLLLATLFSALAGLPWSLYNTFVIEEKHGFNQQTLGFFMKDAIKKFVVTQCILLPVSSLLLYIIKIGGDYFFIYAWLFTLVVSLVLVTIYADYIAPLFDKFTPLPEGKLKEEIEVMAKSIDFPLTKVYVVEGSKRSSHSNAYFYGFFKNKRIVLFDTLLEEYSVLNKDIQEDSGMEPRNEEEGNSEEIKAKVKNKKQGCKNEEVLAVLGHELGHWKLGHTVKNIIISQMNSFLCFFLFAVLIGRKELFAAFGFYDSQPTLIGLLIIFQFIFSPYNEVLSFCLTVLSRRFEFQADAFAKKLGKAKDLYSALIKLNKDNLGFPVSDWLFSMWHYSHPPLLERLQALKTMKQH
-
Molecular Weight
81.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZMPSTE24, also known as ZMPSTE24 metalloprotease, is a crucial enzyme involved in the post-translational modification of proteins, particularly in the processing of prelamin A, a precursor of the nuclear lamina protein lamins. Mutations in the ZMPSTE24 gene are linked to a rare genetic disorder known as Hutchinson-Gilford Progeria Syndrome (HGPS), which leads to premature aging in children. This disease is characterized by various symptoms including growth failure, alopecia, cardiovascular problems, and skeletal abnormalities, all reminiscent of natural aging processes. Understanding ZMPSTE24 and its role in cellular aging has garnered significant attention in biomedical research, as insights into its function may provide potential therapeutic avenues for HGPS and age-related diseases. Furthermore, the study of ZMPSTE24-recombinant proteins has implications for studying the structure-function relationships in lamins and their involvement in nuclear architecture and stability. Research focused on the biochemical activity of ZMPSTE24, the mechanisms of its dysregulation in disease contexts, and the potential for therapeutic interventions aims to improve the understanding of not only progeria but also broader aspects of aging and cellular senescence. Overall, ZMPSTE24 represents a vital area of study that bridges developmental biology, aging, and medical research, providing a richer understanding of how cellular mechanisms contribute to health and disease.
