Analytical Data
-
Gene name
DIO2
- Application
-
Alternative Names
DIO2；ITDI2；TXDI2；Type II iodothyronine deiodinase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92813
-
Expression Region
166-265aa
-
AA Sequence
PSDGWAIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRM DNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKR
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DIO2, or iodothyronine deiodinase type 2, is an enzyme crucial for thyroid hormone metabolism, particularly in the conversion of thyroxine (T4) to its more active form, triiodothyronine (T3). The significance of DIO2 stems from its role in regulating thyroid hormone levels, which are essential for various physiological processes, including metabolism, growth, and development. Abnormalities in DIO2 activity have been linked to several health issues, including thyroid dysfunction, obesity, insulin resistance, and neurological disorders. Given the enzyme's importance, researchers have focused on the production of recombinant DIO2 proteins to better understand its structure-function relationships and enzymatic mechanisms. By utilizing various expression systems (e.g., bacterial, yeast, or mammalian cells), scientists can produce large quantities of DIO2 for biochemical studies, aiding in drug design and therapeutic interventions. The recombinant protein allows for the investigation of substrate specificity, enzyme kinetics, and potential regulatory factors influencing DIO2 activity. This research contributes valuable insights into thyroid hormone metabolism and highlights potential targets for treating related disorders. Understanding DIO2's function could pave the way for novel therapeutic strategies, particularly in managing thyroid-related diseases and metabolic syndromes. Additionally, studying DIO2 in a controlled environment enhances the comprehension of its physiological roles, paving the way for future advancements in endocrinology and metabolism research.
