Analytical Data
-
Gene name
DIO3
- Application
-
Alternative Names
DIO3；ITDI3；TXDI3；Thyroxine 5-deiodinase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55073
-
Expression Region
1-304aa
-
AA Sequence
MPRQATSRLVVGEGEGSQGASGPAATMLRSLLLHSLRLCAQTASCLVLFPRFLGTAFMLWLLDFLCIRKHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYIIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGARPRRV
-
Molecular Weight
33.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DIO3 (Deiodinase Iodothyronine Type 3) is a member of the deiodinase family of enzymes, essential for the metabolism of thyroid hormones. This enzyme plays a critical role in the active conversion of thyroxine (T4) into its inactive form, reverse tri-iodothyronine (rT3), thereby regulating thyroid hormone levels in tissues and influencing various physiological processes. Dysregulation of DIO3 is associated with metabolic disorders, neurological conditions, and cancer, highlighting its importance in health and disease. Research on DIO3 recombinant protein focuses on its structure, function, and potential therapeutic applications. Understanding the enzymatic activity of DIO3 could lead to insights into thyroid hormone signaling pathways and the development of targeted treatments for conditions such as hypothyroidism, obesity, and thyroid-related cancers. The production of recombinant DIO3 offers a robust tool for elucidating its biochemical properties, exploring its interactions with substrates, and assessing the impact of genetic variants. Additionally, characterizing the post-translational modifications and regulatory mechanisms governing DIO3 expression will enhance our understanding of its role in maintaining thyroid hormone homeostasis. Overall, the study of DIO3 recombinant protein serves to bridge gaps in our knowledge of thyroid hormone metabolism and paves the way for innovative approaches to manage thyroid-related disorders.
