Analytical Data
-
Gene name
TIM14
- Application
-
Alternative Names
DnaJ (Hsp40) homolog; subfamily C; member 19; DnaJ homolog subfamily C member 19; DNAJC19; homolog of yeast TIM14; Mitochondrial import inner membrane translocase subunit TIM14; PAM18; TIM 14; TIM14; TIM14_HUMAN; TIMM 14; TIMM14; translocase of the inner mitochondrial membrane 14; Translocase of the inner mitochondrial membrane 14; yeast homolog of
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DA6
-
Expression Region
1-116 aa
-
AA Sequence
MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK
-
Molecular Weight
39.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIM14 (Translocase of Inner Mitochondrial Membrane 14) is a crucial protein involved in mitochondrial protein import and chaperone functions, playing a vital role in maintaining mitochondrial bioenergetics and cell homeostasis. Research on TIM14 has gained prominence due to its implications in various cellular processes and its association with mitochondrial dysfunctions, which are linked to a range of diseases, including neurodegenerative disorders and metabolic syndromes. TIM14 operates within the mitochondrial machinery, facilitating the translocation of precursor proteins across the inner mitochondrial membrane, a critical step in mitochondrial biogenesis and function. Understanding the structure and function of TIM14, as well as its interactions with other mitochondrial components, is essential for unraveling the complexities of mitochondrial dynamics. Additionally, studies have shown that mutations or dysregulation of TIM14 can disrupt mitochondrial protein import pathways, thereby leading to impaired cellular function and contributing to the pathophysiology of several diseases. Consequently, TIM14 has emerged as a potential therapeutic target, with ongoing research aimed at elucidating its mechanisms and identifying strategies to mitigate mitochondrial-related disorders through pharmacological or genetic interventions. The exploration of TIM14's structural properties and regulatory mechanisms continues to provide insights into its pivotal role in cellular health, making it a significant focus in mitochondrial biology and translational medicine.
