Analytical Data
-
Gene name
ELSPBP1
- Application
-
Alternative Names
E12; ELSPBP1; Epididymal secretory protein 12; Epididymal sperm-binding protein 1; ESPB1_HUMAN; hE12
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96BH3
-
Expression Region
1-223aa
-
AA Sequence
MTRWSSYLLGWTTFLLYSYESSGGMHEECVFPFTYKGSVYFTCTHIHSLSPWCATRAVYNGQWKYCQSEDYPRCIFPFIYRGKAYNSCISQGSFLGSLWCSVTSVFDEKQQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPTTENMDKDGKWSFCADTRISALVPGFPCHFPFNYKNKNYFNCTNKGSKENLVWCATSYNYDQDHTWVYC
-
Molecular Weight
50.27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ELSPBP1, or ELL-Specific RNA Polymerase II-Associated Protein 1, is a protein that has garnered attention in the field of molecular biology due to its potential role in various cellular processes, including transcription regulation and mRNA processing. Research has indicated that ELSPBP1 interacts with RNA polymerase II and may be involved in maintaining the stability of mRNA and facilitating transcription elongation. This is particularly significant as proper regulation of these processes is crucial for cellular function and development. Dysregulation of ELSPBP1 has been implicated in several pathological conditions, including cancer, where altered transcriptional landscapes can lead to tumorigenesis. Thus, understanding the structure and function of ELSPBP1 may provide insights into its biological significance and potential therapeutic targets. The production of recombinant ELSPBP1 protein allows for detailed biochemical studies to elucidate its mechanism of action and interactions within the cell. As research advances, elucidating the precise roles of ELSPBP1 in health and disease could contribute to the development of novel strategies for intervention in transcription-related disorders.
