Analytical Data
-
Gene name
CHRM3
- Application
-
Alternative Names
CHRM3；Muscarinic acetylcholine receptor M3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20309
-
Expression Region
253-492aa
-
AA Sequence
RIYKETEKRTKELAGLQASGTEAETENFVHPTGSSRSCSSYELQQQSMKRSNRRKYGRCHFWFTTKSWKPSSEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPEEELGMVDLERKADKLQAQKSVDDGGSFPKSFSKLPIQLESAVDTAKTSDVNSSVGKSTATLPLSFKEATLAKRFALKTRSQITKRKRMSLVKEKKAAQT
-
Molecular Weight
32.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHRM3, or muscarinic acetylcholine receptor M3, is a G protein-coupled receptor that plays a crucial role in various physiological processes, including smooth muscle contraction, glandular secretion, and neurotransmission. Its dysregulation is associated with several pathological conditions, such as asthma, obesity, and cancer. The study of CHRM3 has gained significant attention due to its potential as a therapeutic target for these diseases. Recombinant CHRM3 proteins are often utilized in research to elucidate receptor structure-function relationships, signaling pathways, and pharmacological profiles. By producing and characterizing these recombinant proteins, researchers can explore the receptor's interaction with ligands and its downstream effects in cellular models. This work is essential for drug discovery, providing insights into allosteric modulation and biased signaling, which may lead to the development of novel therapeutics with improved efficacy and fewer side effects. Understanding the precise mechanisms by which CHRM3 operates at the molecular level can pave the way for innovative treatments that harness its physiological functions while mitigating pathological effects. Thus, the recombinant expression and functional analysis of CHRM3 are crucial for advancing our understanding of its role in health and disease.
