Analytical Data
-
Gene name
EIF5B
- Application
-
Alternative Names
Eukaryotic translation initiation factor 5B. eIF-5B. EC:3.6.5.3. Translation initiation factor IF-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60841
-
Expression Region
629-846aa
-
AA Sequence
LRAPIICVLGHVDTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPLEAINEQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIESINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQKKNTKDEFEERAKAIIVEFAQQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVELTQTML
-
Molecular Weight
28.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EIF5B, or Eukaryotic Initiation Factor 5B, plays a crucial role in the process of protein synthesis by facilitating the initiation of translation in eukaryotic cells. This protein is essential for the recruitment of the ribosomal subunits and the proper assembly of the translation initiation complex. Recent studies have highlighted the importance of EIF5B in various biological processes, including cell differentiation, growth, and response to stress. Abnormalities in EIF5B expression and function have been linked to various diseases, particularly cancers, where altered protein synthesis can drive uncontrolled cell proliferation. The recombinant expression of EIF5B has emerged as a valuable tool in molecular biology, enabling researchers to study its structure and function in detail. By producing EIF5B in a controlled laboratory setting, scientists can investigate its interaction with other proteins involved in translation, analyze its biochemical properties, and explore its potential as a therapeutic target. Overall, the study of EIF5B through recombinant protein research provides insights into fundamental cellular mechanisms and potential applications in disease treatment and biotechnology.











