Analytical Data
-
Gene name
ZFP276
- Application
-
Alternative Names
ZNF276; CENP-Z; ZFP276; ZNF477; Zinc finger Protein 276; Zfp-276; Zinc finger Protein 477
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N554
-
Expression Region
1-373 aa
-
AA Sequence
MDTSSSCKAFLLDSALAVKWPRDKETAPRLPQHRGWNPGDAPQTSQGRGTGTPVGAETKTLPSTDVAQPPSDSDAVGPRSGFPPQPSLPLCRAPGQLGEKQLPSSTSDDRVKDEFSDLSEGDVLSEDENDKKQNAQSSDESFEPYPERKVSGKKSESKEAKKSEEPRIRKKPGPKPGWKKKLRCEREELPTIYKCPYQGCTAVYRGADGMKKHIKEHHEEVRERPCPHPGCNKVFMIDRYLQRHVKLIHTEVRNYICDECGQTFKQRKHLLVHQMRHSGAKPLQCEVCGFQCRQRASLKYHMTKHKAETELDFACDQCGRRFEKAHNLNVHMSMVHPLTQTQDKALPLEAEPPPGPPSPSVTTEGQAVKPEPT
-
Molecular Weight
68.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZFP276, a member of the Krüppel-like factor (KLF) family of zinc finger proteins, plays a significant role in various biological processes, including cellular differentiation, proliferation, and the regulation of gene expression. Research on ZFP276 has gained prominence due to its involvement in key developmental pathways and its potential implications in various diseases, particularly cancers and metabolic disorders. Emerging evidence suggests that ZFP276 can influence transcriptional regulation by interacting with specific DNA sequences and other transcription factors, thereby modulating gene expression profiles essential for maintaining cellular homeostasis. The study of recombinant ZFP276 protein has provided valuable insights into its structural and functional properties, allowing researchers to dissect its mechanistic role in signaling pathways. Furthermore, the development of ZFP276 as a recombinant protein has facilitated the exploration of its therapeutic potential, positioning it as a target for drug development aimed at correcting dysregulated transcriptional activity in disease contexts. Given the complexity of its biological functions and interactions, ongoing research aims to elucidate the precise mechanisms through which ZFP276 exerts its effects within cellular systems, ultimately contributing to a better understanding of its role in health and disease.
