Analytical Data
-
Gene name
ZFP1
- Application
-
Alternative Names
ZFP1; ZNF475; Zinc finger Protein 1 homolog; Zfp-1; Zinc finger Protein 475
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6P2D0
-
Expression Region
1-352 aa
-
AA Sequence
MERDHRNPDEQARQFLILKNQTPIEERGDLFGKALNLNTDFVSLRQVPYKYDLYEKTLKYNSDLLNSNRSYAGKQTDECNEFGKALLYLKQEKTHSGVEYSEYNKSGKALSHKAAIFKHQKIKNLVQPFICTYCDKAFSFKSLLISHKRIHTGEKPYECNVCKKTFSHKANLIKHQRIHTGEKPFECPECGKAFTHQSNLIVHQRAHMEKKPYECSECGKTFAQKFELTTHQRIHTGERPYECNECAKTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHMRTHTGEKPYECTECGKTFSQRSTLRLHLRIHTGEKPYECSECGKAFSRKSRLSVHQRVHIGEKP
-
Molecular Weight
67.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZFP1, a zinc finger protein, is a member of the C2H2-type zinc finger protein family, which plays pivotal roles in various biological processes, including transcriptional regulation, DNA binding, and chromatin remodeling. Research on ZFP1 has gained traction due to its potential implications in developmental biology, stem cell differentiation, and gene expression regulation. This protein is particularly interesting because of its ability to interact with specific DNA sequences, thus influencing the transcription of genes involved in crucial cellular functions. Studies have shown that ZFP1 is implicated in various physiological processes, such as cell adhesion and migration, suggesting its potential role in cancer progression and metastasis. Furthermore, its expression patterns during different stages of development hint at its essential role in cellular differentiation and development, making it a promising candidate for targeted gene therapy and regenerative medicine. The recombinant production of ZFP1 has enabled researchers to further investigate its functional properties, interactions, and potential therapeutic applications, paving the way for novel insights into its mechanisms of action and significance in health and disease. As the understanding of ZFP1 deepens, it may open new avenues for innovative strategies in treating various conditions linked to its dysregulation.
