Analytical Data
-
Gene name
ZFP161
- Application
-
Alternative Names
ZBTB14; ZFP161; ZNF478Zinc finger and BTB domain-containing Protein 14; Zinc finger Protein 161 homolog; Zfp-161; Zinc finger Protein 478; Zinc finger Protein 5 homolog; ZF5; Zfp-5; hZF5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43829
-
Expression Region
1-449 aa
-
AA Sequence
MEFFISMSETIKYNDDDHKTLFLKTLNEQRLEGEFCDIAIVVEDVKFRAHRCVLAACSTYFKKLFKKLEVDSSSVIEIDFLRSDIFEEVLNYMYTAKISVKKEDVNLMMSSGQILGIRFLDKLCSQKRDVSSPDENNGQSKSKYCLKINRPIGDAADTQDDDVEEIGDQDDSPSDDTVEGTPPSQEDGKSPTTTLRVQEAILKELGSEEVRKVNCYGQEVESMETPESKDLGSQTPQALTFNDGMSEVKDEQTPGWTTAASDMKFEYLLYGHHREQIACQACGKTFSDEGRLRKHEKLHTADRPFVCEMCTKGFTTQAHLKEHLKIHTGYKPYSCEVCGKSFIRAPDLKKHERVHSNERPFACHMCDKAFKHKSHLKDHERRHRGEKPFVCGSCTKAFAKASDLKRHENNMHSERKQVTPSAIQSETEQLQAAAMAAEAEQQLETIACS
-
Molecular Weight
77.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZFP161, a member of the zinc finger protein family, has garnered attention in recent research due to its potential role in gene regulation and cellular processes. Zinc finger proteins are characterized by the presence of zinc ion-coordinating structural motifs, which enable them to bind DNA and RNA, influencing transcriptional activity. ZFP161 specifically is believed to be involved in the modulation of gene expression during critical biological processes such as development, differentiation, and apoptosis. Studies have indicated that ZFP161 may play a significant role in various pathological conditions, including cancer and developmental disorders, as it is implicated in the regulation of key oncogenes and tumor suppressor genes. The research involving recombinant ZFP161 protein aims to elucidate its molecular mechanisms and functional significance, employing techniques such as gene editing, protein-protein interaction assays, and signaling pathway analysis. By producing and studying recombinant ZFP161, researchers hope to explore its potential as a therapeutic target and to provide insights into the intricate networks of gene regulation it participates in. Overall, the investigation of ZFP161 not only enhances our understanding of zinc finger proteins but also holds promise for advancing strategies in disease treatment and biotechnological applications.
