Analytical Data
-
Gene name
TERF2
- Application
-
Alternative Names
TERF2；TRBF2；TRF2；Telomeric repeat-binding factor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15554
-
Expression Region
1-251aa
-
AA Sequence
MAGGGGSSDGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAGEARLEE AVNRWVLKFYFHEALRAFRGSRYGDFRQIRDIMQALLVRPLGKEHTVSRL LRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIKTEFTLTEAVV ESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIR EKNLAHPVIQNFSYETFQQKMLRFLESHLDDAEPYLLTVRLGPSPITMVC P
-
Molecular Weight
55 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TERF2, or Telomeric Repeat-binding Factor 2, is a crucial protein involved in the maintenance of telomeres, the protective caps at the ends of linear chromosomes that play a significant role in cellular aging and genomic stability. Research into TERF2 has gained importance as it is implicated in various biological processes, including DNA repair, cellular senescence, and the regulation of telomere length. Alterations in TERF2 expression and function have been associated with several cancers, making it a potential biomarker and therapeutic target. The study of recombinant TERF2 proteins has facilitated investigations into its structural and functional properties, allowing researchers to dissect the molecular mechanisms by which TERF2 contributes to telomere maintenance and stability. Recombinant techniques provide insights into the protein’s interactions with other telomeric proteins, as well as its role in modulating telomerase activity. Understanding the biology of TERF2 at a molecular level is essential for unraveling its contributions to aging and cancer pathogenesis, offering potential pathways for novel therapeutic strategies aimed at enhancing genomic integrity.
