Analytical Data
-
Gene name
SPLUNC2
- Application
-
Alternative Names
SPLUNC2；C20orf70；SPLUNC2；BPI fold-containing family A member 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DR5
-
Expression Region
19-249aa
-
AA Sequence
ESLLDNLGNDLSNVVDKLEPVLHEGLETVDNTLKGILEKLKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQIINLKASLDLLTAVTIETDPQTHQPVAVLGECASDPTSISLSLLDKHSQIINKFVNSVINTLKSTVSSLLQKEICPLIRIFIHSLDVNVIQQVVDNPQHKTQLQTLI
-
Molecular Weight
41.1kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPLUNC2 (Secreted PLA2-Unique New Peptide 2) is a member of the SPLUNC family, known for its roles in respiratory health and host defense. It is primarily expressed in the epithelial cells of the airway and is believed to play a crucial role in maintaining mucosal surfaces and promoting innate immunity. Recent studies have highlighted SPLUNC2's involvement in modulating inflammation and its potential as a biomarker for respiratory diseases, including asthma and chronic obstructive pulmonary disease (COPD). Researchers have focused on recombinant SPLUNC2 proteins to better understand their functional properties and therapeutic potential, particularly in enhancing mucosal immunity and addressing dysregulation during pulmonary infections. By characterizing the structure and activity of SPLUNC2, scientists aim to elucidate its mechanisms in mucosal defense and explore its potential applications in clinical settings. The development of recombinant SPLUNC2 not only aids in the investigation of its biological functions but also paves the way for novel therapeutic strategies aimed at reinforcing airway protection and combating respiratory disorders.
