Analytical Data
-
Gene name
ZEB1
- Application
-
Alternative Names
Zinc finger E-box-binding homeobox 1; Zinc finger homeodomain enhancer binding Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P37275
-
Expression Region
1-900 aa
-
AA Sequence
NIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZEB1 (Zinc Finger E-Box Binding Homeobox 1) is a crucial transcriptional regulator that plays a significant role in embryonic development, cellular differentiation, and epithelial-mesenchymal transition (EMT). Emphasizing its importance in cancer biology, ZEB1 is often overexpressed in various malignancies, promoting tumor invasion, metastasis, and resistance to therapy. As a member of the ZEB family of transcription factors, ZEB1 functions by repressing epithelial markers while enhancing mesenchymal markers, effectively facilitating the transition that allows cancer cells to acquire migratory and invasive properties. Its dysregulation has been linked to poor prognosis in diverse cancers, making it a potential target for therapeutic intervention. Recent advances in protein engineering have enabled the creation of recombinant ZEB1 proteins, providing essential tools for studying its structure-function relationship and interaction with other molecular partners. By generating and characterizing these recombinant proteins, researchers aim to elucidate the underlying mechanisms of ZEB1's role in cancer progression and EMT, ultimately contributing to the development of novel strategies for cancer treatment. Thus, the investigation of recombinant ZEB1 proteins represents a promising avenue for understanding the complexities of tumor biology and identifying new biomarkers or therapeutic targets.
