Analytical Data
-
Gene name
SPLUNC3
- Application
-
Alternative Names
SPLUNC3；C20orf71；SPLUNC3；BPI fold-containing family A member 3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BQP9
-
Expression Region
1-254aa
-
AA Sequence
MMCPLWRLLIFLGLLALPLAPHKQPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASAQVAPGLVGWLISGRKHQQQQESSINITNIQLDCGGIQISFHKEWFSANISLEFDLELRPSFDNNIVKMCAHMSIVVEFWLEKDEFGRRDLVIGKCDAEPSSVHVAILTEAIPPKMNQFLYNLKENLQKVLPHMVESQVCPLIGEILGQLDVKLLKSLIEQEAAHEPTHHETSQPSACQAGESPS
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SPLUNC3, a member of the sapien family of proteins, has garnered increasing attention in the field of biomedical research due to its potential role in innate immunity and respiratory health. Initially identified in the human airway epithelium, SPLUNC3 exhibits antibacterial properties and may play a critical role in mucosal defense mechanisms. Its expression is primarily localized in the respiratory tract and associated tissues, suggesting it may be involved in protecting these vital areas from microbial infections and inflammation. Recent studies have indicated that SPLUNC3 might influence airway surface liquid composition and mucociliary clearance, which are essential for maintaining respiratory hygiene. Moreover, alterations in SPLUNC3 levels have been linked to various respiratory diseases, including asthma and chronic obstructive pulmonary disease (COPD), prompting investigations into its therapeutic potential. The recombinant production of SPLUNC3 provides a valuable tool for understanding its biological functions, structure-function relationships, and its mechanisms in disease processes. By studying SPLUNC3 through recombinant protein techniques, researchers aim to elucidate its interactions with pathogens and other immune components, which may pave the way for novel therapeutic strategies targeting respiratory conditions. With ongoing research, SPLUNC3 holds promise not only as a biomarker but also as a potential therapeutic agent in enhancing respiratory health and combating related diseases.
