Cat: PA2000-7317

Recombinant Human EIF3S6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EIF3S6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    eIF-3 p48; eIF3e; EIF3E_HUMAN; EIF3S6; eIFe; Eukaryotic translation initiation factor 3 subunit 6; Eukaryotic translation initiation factor 3 subunit E; eukaryotic translation initiation factor 3; subunit 6 (48kD); INT6; mammary tumor-associated protein INT6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P60228

  • Expression Region

    1-445aa

  • AA Sequence

    MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY

  • Molecular Weight

    79.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EIF3S6, part of the eukaryotic translation initiation factor 3 (eIF3) complex, plays a crucial role in the regulation of protein synthesis by facilitating the assembly of the translation machinery. The interest in EIF3S6 has grown due to its involvement in various cellular processes beyond translation, such as cell proliferation, differentiation, and apoptosis. Recent studies have indicated that aberrations in eIF3 complex components, including EIF3S6, are linked to several diseases, particularly cancers. As a result, investigating EIF3S6 as a recombinant protein has become essential for understanding its functional mechanisms and interactions within the eIF3 complex. The ability to express and purify EIF3S6 as a recombinant protein allows for detailed biochemical and structural analyses, enabling researchers to dissect its role in translation initiation and potential implications in disease pathology. Moreover, generating specific antibodies against EIF3S6 can aid in the study of its expression patterns in various tissues and under different physiological conditions. This research not only enhances our understanding of fundamental cellular processes but also opens avenues for developing targeted therapeutic strategies against diseases associated with dysregulated protein synthesis and eIF3 complex dysfunction. With these studies, scientists aim to elucidate the broader implications of EIF3S6 in translational control and its potential as a biomarker or therapeutic target in cancer and other related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US