Cat: PA2000-7316

Recombinant Human EIF3S5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EIF3S5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Deubiquitinating enzyme eIF3f; eIF 3 epsilon; eIF-3-epsilon; eIF3 p47; eIF3 p47 subunit; eIF3-epsilon; eIF3-p47; eIF3f; EIF3F_HUMAN; EIF3S5; EIF3S5; formerly; Eukaryotic translation initiation factor 3 subunit 5; Eukaryotic translation initiation factor 3 subunit 5; formerly; Eukaryotic translation initiation factor 3 subunit F; eukaryotic translation initiation factor 3; subunit 5 (epsilon; 47kD); eukaryotic translation initiation factor 3; subunit 5 epsilon; 47kDa; eukaryotic translation initiation factor 3; subunit F; translation initiation factor 3 47 kda subunit

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00303

  • Expression Region

    1-323aa

  • AA Sequence

    MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDF

  • Molecular Weight

    60.7kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EIF3S5, or Eukaryotic Translation Initiation Factor 3 Subunit 5, is a crucial component of the eukaryotic translation initiation complex, playing a significant role in the recruitment of ribosomes to mRNA. Research on EIF3S5 has garnered attention due to its involvement in various cellular processes, including the control of protein synthesis, cellular growth, and responses to stress. Abnormal expression levels of EIF3S5 have been linked to several pathological conditions, including cancer, making it a potential biomarker and therapeutic target. Understanding the structural and functional mechanisms of EIF3S5 is essential for elucidating its role in ribosome assembly and the overall translation initiation process. Recent studies utilizing recombinant protein techniques have focused on the characterization of EIF3S5, aiming to elucidate its interactions with other translation factors and RNA molecules. These insights may pave the way for novel interventions in diseases characterized by dysregulated protein synthesis. Overall, research on EIF3S5 is critical for advancing our knowledge of translational regulation and its implications in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US