Analytical Data
-
Gene name
ZDHHC9
- Application
-
Alternative Names
ZDHHC9; CXorf11; ZDHHC10; ZNF379; ZNF380; CGI-89; UNQ261/PRO298; Palmitoyltransferase ZDHHC9; Zinc finger DHHC domain-containing Protein 9; DHHC-9; DHHC9; Zinc finger Protein 379; Zinc finger Protein 380
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y397
-
Expression Region
1-364 aa
-
AA Sequence
MSVMVVRKKVTRKWEKLPGRNTFCCDGRVMMARQKGIFYLTLFLILGTCTLFFAFECRYLAVQLSPAIPVFAAMLFLFSMATLLRTSFSDPGVIPRALPDEAAFIEMEIEATNGAVPQGQRPPPRIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFILSLSLLTIYVFAFNIVYVALKSLKIGFLETLKETPGTVLEVLICFFTLWSVVGLTGFHTFLVALNQTTNEDIKGSWTGKNRVQNPYSHGNIVKNCCEVLCGPLPPSVLDRRGILPLEESGSRPPSTQETSSSLLPQSPAPTEHLNSNEMPEDSSTPEEMPPPEPPEPPQEAAEAEK
-
Molecular Weight
67.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZDHHC9, a member of the z DHHC-type zinc finger protein family, has garnered significant attention due to its critical role in palmitoylation, a post-translational modification that influences protein stability, localization, and function. This enzyme attaches palmitate, a 16-carbon saturated fatty acid, to cysteine residues in target proteins, thereby impacting various cellular processes, including signal transduction, membrane dynamics, and neuronal development. Research has shown that mutations and dysregulation of ZDHHC9 are linked to several neurological disorders, including intellectual disabilities and autism spectrum disorders, highlighting its importance in brain function. Understanding the structural and functional characteristics of ZDHHC9 is essential for elucidating its mechanism of action and its contribution to these pathologies. The study of ZDHHC9 recombinant proteins aids in the identification of novel substrates and interaction partners, providing insights into the enzymatic activity and regulatory networks involved in palmitoylation. Additionally, investigating ZDHHC9’s role in specific cell types, such as neurons, can unveil its significance in synaptic plasticity and neurodevelopmental processes. Continued research on ZDHHC9 may lead to therapeutic targets for the treatment of related diseases, emphasizing its potential impact on both basic science and clinical applications.
