Analytical Data
-
Gene name
ZCCHC9
- Application
-
Alternative Names
ZCCHC9; Zinc finger CCHC domain-containing Protein 9
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N567
-
Expression Region
1-271 aa
-
AA Sequence
MTRWARVSTTYNKRPLPATSWEDMKKGSFEGTSQNLPKRKQLEANRLSLKNDAPQAKHKKNKKKKEYLNEDVNGFMEYLRQNSQMVHNGQIIATDSEEVREEIAVALKKDSRREGRRLKRQAAKKNAMVCFHCRKPGHGIADCPAALENQDMGTGICYRCGSTEHEITKCKAKVDPALGEFPFAKCFVCGEMGHLSRSCPDNPKGLYADGGGCKLCGSVEHLKKDCPESQNSERMVTVGRWAKGMSADYEEILDVPKPQKPKTKIPKVVNF
-
Molecular Weight
56.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZCCHC9 is a member of the Zinc Finger CCHC-type containing proteins, which play vital roles in various cellular processes, including RNA metabolism and virus-host interactions. Recent studies have highlighted its significance in the regulation of gene expression and cellular stress responses, underscoring its potential involvement in diseases like cancer and viral infections. ZCCHC9 has been found to interact with various RNA molecules, suggesting a regulatory role in RNA processing and stability. The exploration of ZCCHC9's biochemical properties, including its three-dimensional structure, aims to elucidate its functional mechanisms within the cell. Understanding ZCCHC9's role at the molecular level is crucial for developing novel therapeutic strategies targeting its pathways, particularly in contexts where dysregulation of RNA metabolism contributes to disease progression. Additionally, research into ZCCHC9's interactions with other proteins and nucleic acids can reveal new insights into the intricate networking of cellular functions. Thus, the study of ZCCHC9 is not only important for basic cellular biology but also for its implications in disease mechanisms, providing a promising avenue for future research in therapeutics and molecular medicine.
