Analytical Data
-
Gene name
GnRHR
- Application
-
Alternative Names
GnRHR；GRHR；Gonadotropin-releasing hormone receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P30968
-
Expression Region
1-328aa
-
AA Sequence
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRVLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL
-
Molecular Weight
37.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Gonadotropin-releasing hormone receptor (GnRHR) plays a pivotal role in the regulation of the hypothalamic-pituitary-gonadal (HPG) axis, which is fundamental for reproductive function in both males and females. Research on GnRHR is primarily driven by its significance in reproductive health and disorders, such as precocious puberty, hypogonadism, and infertility. The binding of GnRH to its receptor activates a cascade of intracellular signaling pathways that lead to the release of gonadotropins, luteinizing hormone (LH), and follicle-stimulating hormone (FSH), which are essential for normal reproductive processes. However, due to its low expression levels and the complexity of its signaling mechanisms, studying GnRHR has posed significant challenges. The advent of recombinant DNA technology has enabled the production of GnRHR as a recombinant protein, facilitating in-depth functional studies. This approach not only allows for the characterization of receptor-ligand interactions but also aids in the development of novel therapeutic agents targeting GnRHR for the treatment of reproductive disorders. Moreover, understanding the structural and functional properties of GnRHR through recombinant protein studies could unveil new insights into its role in the HPG axis and its potential implications for endocrine regulation. Overall, the study of GnRHR recombinant proteins is essential for advancing our knowledge of reproductive biology and developing targeted therapies for associated conditions.
