Analytical Data
-
Gene name
TEX261
- Application
-
Alternative Names
TEX261; UNQ1882/PRO4325; Protein TEX261
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UWH6
-
Expression Region
1-196 aa
-
AA Sequence
MWFMYLLSWLSLFIQVAFITLAVAAGLYYLAELIEEYTVATSRIIKYMIWFSTAVLIGLYVFERFPTSMIGVGLFTNLVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEEYYPFSEVLAYFTFCLWIIPFAFFVSLSAGENVLPSTMQPGDDVVSNYFTKGKRGKRLGILVVFSFIKEAILPSRQKIY
-
Molecular Weight
48.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TEX261 is a protein that has garnered interest in the fields of molecular biology and biochemistry due to its potential role in cellular processes and its implications in human health and disease. As a member of the TEX family of proteins, TEX261 is believed to be involved in the regulation of gene expression and cell signaling pathways. Recent studies have suggested that TEX261 may play a critical role in spermatogenesis, cellular stress responses, and immune system functioning. The understanding of its structure and function can provide insights into male fertility issues and certain autoimmune conditions. The recombinant production of TEX261 allows researchers to study its biochemical properties in detail, facilitating the exploration of its interactions with other cellular proteins and its role in various biological processes. Investigating the role of TEX261 through recombinant techniques can contribute to the development of targeted therapies and diagnostics, particularly in conditions where its expression is altered. Overall, the study of TEX261 not only enhances our understanding of fundamental biological mechanisms but also opens avenues for therapeutic interventions in diseases linked to its dysfunction.
