Analytical Data
-
Gene name
ZCCHC13
- Application
-
Alternative Names
ZCCHC13; Zinc finger CCHC domain-containing Protein 13
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WW36
-
Expression Region
1-166 aa
-
AA Sequence
MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNCGRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMSQ
-
Molecular Weight
44.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZCCHC13, a member of the zinc finger CCCH-type containing protein family, has garnered attention for its potential roles in various cellular processes, including RNA metabolism and gene regulation. Previous studies have indicated that ZCCHC13 is involved in the post-transcriptional regulation of gene expression, particularly through its interaction with RNA and other regulatory proteins. Notably, its implications in cancer biology have been highlighted, suggesting that ZCCHC13 may play a role in tumorigenesis and cell proliferation. Researchers aim to understand the structural and functional characteristics of ZCCHC13, which could reveal insights into its molecular mechanisms and wider biological significance. The recombinant expression of ZCCHC13 protein allows for detailed studies on its interactions, functions, and potential therapeutic applications. By using techniques such as crystallography and mass spectrometry, scientists are uncovering the protein's tertiary structure and binding properties, establishing a foundation for future investigations into its role in health and disease. Overall, the research on ZCCHC13 not only contributes to our understanding of RNA-binding proteins but also opens avenues for exploring new targets in cancer therapy and other disorders linked to dysregulated gene expression.
