Analytical Data
-
Gene name
TESPA1
- Application
-
Alternative Names
TESPA1; KIAA0748; HSPC257Protein TESPA1; Thymocyte-expressed positive selection-associated Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A2RU30
-
Expression Region
1-394 aa
-
AA Sequence
MTGGTNKTSSSISEILDKVQEDAEDVLFSLGFGQEDHKDTSRIPARFFTTPSQAKGIDFQLFLKSQVRRIEMEDPCLMLASRFKQVQTLAVTADAFFCLYSYVSKTPVQKFTPSHMFWNCNHPTDVPSIRILSREPEPQSPRDRLRKAISKMCLYTCPRDRPPPPHNTPKRNSLDQVVLEVMDKVKEEKQFLQQDSDLGQFSQEDPVPPAEGKKLPTSPYPCVFCCEEETQQRMSTVLAPSQTLDSNPKVPCCTHSLPIEDPQWSTDPAQIRRELCSLPATNTETHPAKDETFWKRKSRARKSLFQKNLMGRKVKSLDLSITQQKWKQSVDRPELRQSLSQQPQDTFDLEEVQSNSEEEQSQSRWPSRPRHPHHHQTFAGKFVKLSPPPQQHVV
-
Molecular Weight
71.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TESPA1 (T-cell expressed sequence 1) is a protein that has garnered attention in the field of immunology and cellular biology due to its potential role in T-cell function and activation. Originally identified as a gene expressed in T cells, TESPA1 is thought to be involved in the regulation of immune responses, particularly in the context of T-cell receptor (TCR) signaling. Dysregulation of TESPA1 has been implicated in autoimmune diseases, suggesting that it plays a critical role in maintaining immune homeostasis. Researchers have been investigating the structural characteristics and functional mechanisms of TESPA1 to better understand its interactions within the immune system. Recent studies have focused on the development of recombinant TESPA1 proteins for use as tools in experimental research, such as characterizing its binding interactions with other proteins, studying its role in T-cell activation, and assessing its potential as a therapeutic target in immunotherapy. The production of TESPA1 recombinant proteins not only aids in elucidating its biological functions but also provides insights into the molecular pathways that underlie T-cell-associated conditions. Overall, TESPA1 remains a significant focus of research, with the aim of uncovering its contributions to immune regulation and exploring its potential implications in therapeutic strategies for immune-related disorders.
