Analytical Data
-
Gene name
TEK
- Application
-
Alternative Names
Angiopoietin-1 receptor. EC:2.7.10.1. Endothelial tyrosine kinase. Tunica interna endothelial cell kinase. Tyrosine kinase with Ig and EGF homology domains-2. Tyrosine-Protein kinase receptor TEK. Tyrosine-Protein kinase receptor TIE-2. hTIE2. p140 TEK. CD202b
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q02763
-
Expression Region
1-237 aa
-
AA Sequence
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK
-
Molecular Weight
52.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TEK, also known as Tie2, is a receptor tyrosine kinase that plays a crucial role in vascular development and homeostasis. Research on TEK has gained significant attention due to its involvement in angiogenesis, the process by which new blood vessels form from existing ones, which is pivotal in various physiological and pathological conditions, including tumor growth and wound healing. Studies have demonstrated that TEK is primarily expressed in endothelial cells and regulates key functions such as cell survival, migration, and permeability. The exploration of TEK has led to the development of recombinant TEK proteins, which serve as valuable tools for understanding its signaling pathways and therapeutic potential. These recombinant proteins enable researchers to examine the effects of TEK modulation in different biological contexts, paving the way for innovative strategies in treating diseases characterized by abnormal angiogenesis, such as cancer and diabetic retinopathy. Furthermore, the ability to produce TEK as a recombinant protein facilitates detailed structural and functional studies, offering insights into its interaction with ligands and downstream signaling partners. Consequently, ongoing research into TEK recombinant proteins holds promise for unraveling the complexities of vascular biology and identifying novel therapeutic targets to enhance disease management.
