Analytical Data
-
Gene name
ZCCHC11
- Application
-
Alternative Names
DKFZp779C1943; EC 2.7.7.52; FLJ42878; KIAA0191; PAP associated domain containing 3; PAPD3; Terminal uridylyltransferase 4; TUT4; TUT4_HUMAN; TUTase 4; ZCCHC 11; Zcchc11; Zinc finger CCHC domain containing 11; Zinc finger CCHC domain containing Protein 11; Zinc finger CCHC domain-containing Protein 11
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TAX3
-
Expression Region
1-309 aa
-
AA Sequence
MEESKTLKSENHEPKKNVICEESKAVQVIGNQTLKARNDKSVKEIENSSPNRNSSKKNKQNDICIEKTEVKSCKVNAANLPGPKDLGLVLRDQSHCKAKKFPNSPVKAEKATISQAKSEKATSLQAIAEKSPKSPNSVKAEKASSYQMKSEKVPSSPAEAEKGPSLLLKDMRQKTELQQIGKKIPSSFTSVDKVNIEAVGGEKCALQNSPRSQKQQTCTDNTGDSDDSASGIEDVSDDLSKMKNDESNKENSSEMDYLENATVIDESALTPEQRLGLKQAEERLERDHIFRLEKVYYVVLVIWGEMCVS
-
Molecular Weight
60.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZCCHC11 is a member of the ZCCHC family of proteins, characterized by a zinc finger domain that suggests a role in RNA metabolism and gene regulation. Research into ZCCHC11 has gained traction due to its potential implications in various biological processes and disease states. Initial studies indicated that ZCCHC11 plays a role in the regulation of gene expression through its involvement in nucleic acid binding and modification, which may influence cellular responses to stress and developmental cues. Moreover, emerging evidence suggests that abnormalities in ZCCHC11 function could be linked to several diseases, including various cancers and neurodegenerative disorders. Given its potential as a therapeutic target, scientists are increasingly focusing on the characterization and functional analysis of ZCCHC11, employing techniques like recombinant protein expression. By producing ZCCHC11 as a recombinant protein, researchers aim to elucidate its structural properties, interaction partners, and biological functions in vitro. This foundational knowledge may pave the way for further studies aimed at understanding the mechanistic roles of ZCCHC11 in health and disease, providing insights that could inform the development of novel therapeutic strategies. Understanding the molecular dynamics of ZCCHC11 is crucial for leveraging its biological significance, ultimately enhancing our comprehension of RNA biology and its implications in human health.
