Analytical Data
-
Gene name
ZCCHC10
- Application
-
Alternative Names
2410141K03Rik; AA675321; D11Ertd416e; FLJ20094; OTTMUSP00000000071; RP23-226J16.1; Zcchc10; ZCH10_HUMAN; Zinc finger CCHC domain-containing Protein 10; zinc finger. CCHC domain containing 10
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TBK6
-
Expression Region
1-170 aa
-
AA Sequence
MATPMHRLIARRQAEANKQHVRCQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKENRLLLQQSIGETNVERKAKKKRSKSVTSSSSSSSDSSASDSSSESEETSTSSSSEDSDTDESSSSSSSSASSTTSSSSSDSDSDSSSSSSSSTSTDSSSDDEPPKKKKKK
-
Molecular Weight
44.44 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZCCHC10, a member of the zinc finger CCHC-type containing protein family, has garnered attention in the field of molecular biology due to its potential roles in various cellular processes, including RNA metabolism and regulation. Research has indicated that ZCCHC10 may be involved in post-transcriptional modifications, influencing gene expression and cellular responses to environmental stressors. Notably, its expression patterns have been linked to developmental processes and certain disease states, including cancer. Scientists are particularly interested in understanding the protein's functional mechanisms and interactions with other cellular components, as these may reveal insights into its contributions to pathophysiology. Furthermore, the exploration of ZCCHC10 as a potential therapeutic target is gaining momentum, given its implications in disease mechanisms. The recombinant expression and purification of ZCCHC10 are critical steps in facilitating structural and functional studies, enabling researchers to elucidate its biological role and interactions. Overall, ZCCHC10 represents a promising avenue for future research aimed at uncovering novel regulatory networks and therapeutic strategies in the realm of gene expression and disease.
